LL-37 SKE peptide

Name LL-37 SKE
Synonyms SK-21
Sequence SKEKIGKEFKRIVQRIKDFLR
3-letter-code Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg
Molecular weight 2619.15
Counter ion TFA
Description This LL-37 fragment corresponds to aa 142-162 of the human cationic antimicrobial protein 18 (hCAP18).
               

Order LL-37 SKE peptide

Amount Cat.No.        Unit price    
  1 mg SP-4581-1 340 EUR   BUY
  5 mg SP-4581-5 670 EUR   BUY
 
For larger amounts please inquire.  

LL-37 SKE antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Cys-LL-37 CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 (acetate) LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 : Ultra-pure LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES
LL-37 FK-13 FKRIVQRIKDFLR
LL-37 FKR FKRIVQRIKDFLRNLVPRTES
LL-37 GKE GKEFKRIVQRIKDFLRNLVPR
LL-37 KRI KRIVQRIKDFLRNLVPRTES
LL-37 LLG LLGDFFRKSKEKIGKEFKRIV
LL-37 RKS RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC