Cys-LL-37 peptide

Name Cys-LL-37
Sequence CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
3-letter-code Cys - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser
Notes LL-37 with N-terminal Cystein.
Molecular weight 4596.47
Counter ion TFA
Solubilization Soluble in pure water.
Description Synthetic peptide corresponding to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18), with a Cys added to the N-terminus.
References Schmidtchen A, Frick IM, Andersson E, Tapper H, Björck L. 2002. Proteinases of common pathogenic bacteria degrade and inactivate the antibacterial peptide LL-37. Mol Microbiol. 2002 46(1):157-168.
               

Order Cys-LL-37 peptide

Amount Cat.No.        Unit price    
  1 mg SP-CLL37-1 430 EUR   BUY
  5 mg SP-CLL37-5 1390 EUR   BUY
 
For larger amounts please inquire.  

Cys-LL-37 antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 (acetate) LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 : Ultra-pure LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES
LL-37 FK-13 FKRIVQRIKDFLR
LL-37 FKR FKRIVQRIKDFLRNLVPRTES
LL-37 GKE GKEFKRIVQRIKDFLRNLVPR
LL-37 KRI KRIVQRIKDFLRNLVPRTES
LL-37 LLG LLGDFFRKSKEKIGKEFKRIV
LL-37 RKS RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 SKE SKEKIGKEFKRIVQRIKDFLR
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC