Antimicrobial peptides

Anti-microbial peptides (AMPs), which also are called host defence peptides, are broadspectrum antibiotics shown to kill among others bacteria, enveloped viruses, and fungi. AMPs are amphipathic, which enables them to partition into the membrane lipid bilayer. This ability does not necessarily allow for membrane permeabilisation (see Cell permeable peptides). Innovagen currently provides a range of AMPs, most popular of which are the LL-37 and the Defensin peptides.

LL-37

Order LL-37 peptide

Amount Cat.No.        Unit price    
  1 mg SP-LL37-1 350 EUR   BUY
  1 mg x 2 SP-LL37-1x2 510 EUR   BUY
  5 mg SP-LL37-5 960 EUR   BUY
 
For larger amounts please inquire.  

beta Defensin 2

Order beta Defensin 2 peptide

Amount Cat.No.        Unit price    
  0.1 mg SP-BDF2-1 250 EUR   BUY
 
For larger amounts please inquire.  


More antimicrobial peptides

A part from the peptides listed, you could have any sequence in any amount custom made.

Name   Sequence         Info
alpha Defensin 1 (human) ACYCRIPACIAGERRYGTCIYQGRLWAFCC More info
alpha Defensin 2 (human) CYCRIPACIAGERRYGTCIYQGRLWAFCC More info
alpha Defensin 3 (human) DCYCRIPACIAGERRYGTCIYQGRLWAFCC More info
alpha Defensin 4 (human) VCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRV More info
alpha Defensin 5 (human) ATCYCRTGRCATRESLSGVCEISGRLYRLCCR More info
alpha Defensin 6 (human) AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL More info
beta Defensin 1 (human) DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK More info
beta Defensin 2 (human) GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP More info
beta Defensin 3 (human) GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK More info
beta Defensin 4 (human) ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK More info
CAP-18 GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY More info
CRAMP GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ More info
CRAMP 1-39 ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ More info
Cys-LL-37 CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES More info
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC More info
Dermcidin, DCD-1L SSLLEKGLDG AKKAVGGLGK LGKDAVEDLE SVGKGAVHDV KDVLDSVL More info
Hepcidin, human DTHFPICIFCCGCCHRSKCGMCCKT More info
Histatin-3 DSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN -amide More info
Histatin-5 DSHAKRHHGYKRKFHEKHHSHRGY More info
Histatin-8 KFHEKHHSHRGY More info
HP 2-20 AKKVFKRLEKLFSKIQNDK More info
Indolicidin ILPWKWPWWPWRR -amide More info
LL-37 [LL-37, 37 aa] More info
LL-37 (acetate) [LL-37, 37 aa] More info
LL-37 : Ultra-pure [LL-37, 37 aa] More info
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES More info
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC More info
Mundticin KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWSK More info
Pexiganan GIGKFLKKAKKFGKAFVKILKK -amide More info
PR-39 RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP -amide More info
rCRAMP RFKKISRLAGLLRKGGEKFGEKLRKIGQKIKDFFQKLAPEIEQ More info
rCRAMP (10-43) GLLRKGGEKFGEKLRKIGQKIKDFFQKLAPEIEQ More info