Antimicrobial peptides

Anti-microbial peptides (AMPs), which also are called host defence peptides, are broadspectrum antibiotics shown to kill among others bacteria, enveloped viruses, and fungi. AMPs are amphipathic, which enables them to partition into the membrane lipid bilayer. This ability does not necessarily allow for membrane permeabilisation (see Cell permeable peptides). Innovagen currently provides a range of AMPs, most popular of which are the LL-37 and the Defensin peptides.


Order LL-37 peptide

Amount Cat.No.        Unit price    
  1 mg SP-LL37-1 350 EUR   BUY
  1 mg x 2 SP-LL37-1x2 500 EUR   BUY
  5 mg SP-LL37-5 950 EUR   BUY
For larger amounts please inquire.  

beta Defensin 2

Order beta Defensin 2 peptide

Amount Cat.No.        Unit price    
  0.1 mg SP-BDF2-1 250 EUR   BUY
For larger amounts please inquire.  

More antimicrobial peptides

A part from the peptides listed, you could have any sequence in any amount custom made.

Name   Sequence         Info
alpha Defensin 1 (human) ACYCRIPACIAGERRYGTCIYQGRLWAFCC More info
alpha Defensin 2 (human) CYCRIPACIAGERRYGTCIYQGRLWAFCC More info
alpha Defensin 3 (human) DCYCRIPACIAGERRYGTCIYQGRLWAFCC More info
Histatin-8 KFHEKHHSHRGY More info
Indolicidin ILPWKWPWWPWRR -amide More info
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES More info
Pexiganan GIGKFLKKAKKFGKAFVKILKK -amide More info