Beta Amyloid peptides

Beta Amyloid peptides are processed from the Amyloid Precursor Protein (APP) and are thought to play a role in the development of the senile plaques associated with Alzheimer's Disease. However, it has also been found that Abeta has multiple non-disease activities. Innovagen currently provides a range of these Beta Amyloid peptides and analogues.

Beta Amyloid 1-40

More details, peptide analogues, modifications, related peptides, etc.

Order Beta Amyloid 1-40 peptide

Amount Cat.No.        Unit price    
  1 mg SP-BA40-1 170 EUR   BUY
  5 mg SP-BA40-5 790 EUR   BUY
For larger amounts please inquire.  

Beta Amyloid 1-42

More details, peptide analogues, modifications, related peptides, etc.

Order Beta Amyloid 1-42 peptide

Amount Cat.No.        Unit price    
  1 mg SP-BA42-1 230 EUR   BUY
  5 mg SP-BA42-5 1080 EUR   BUY
For larger amounts please inquire.  

Beta Amyloid 29-40

More details, peptide analogues, modifications, related peptides, etc.

Order Beta Amyloid 29-40 peptide

Amount Cat.No.        Unit price    
  1 mg SP-BA2940-1 60 EUR   BUY
  5 mg SP-BA2940-5 240 EUR   BUY
For larger amounts please inquire.  

Beta Amyloid 29-42

More details, peptide analogues, modifications, related peptides, etc.

Order Beta Amyloid 29-42 peptide

Amount Cat.No.        Unit price    
  1 mg SP-BA2942-1 260 EUR   BUY
  5 mg SP-BA2942-5 580 EUR   BUY
For larger amounts please inquire.  

Name   Sequence         Info
Beta Amyloid 1-11 DAEFRHDSGYE More info
Beta Amyloid 1-12 DAEFRHDSGYEV More info
Beta Amyloid 1-15 DAEFRHDSGYEVHHQ More info
Beta Amyloid 1-15 scrambled HFDQHRVEDHAYGES More info
Beta Amyloid 1-16 DAEFRHDSGYEVHHQK More info
Beta Amyloid 10-19 YEVHHQKLVF More info
Beta Amyloid 10-20 YEVHHQKLVFF More info
Beta Amyloid 11-20 EVHHQKLVFF More info
Beta Amyloid 11-40, Pyr11 (Pyr)VHHQKLVFFAEDVGSNKGAIIGLMVGGVV More info
Beta Amyloid 11-42, Pyr11 (Pyr)VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA More info
Beta Amyloid 12-28 VHHQKLVFFAEDVGSNK More info
Beta Amyloid 12-28; V18P VHHQKLPFFAEDVGSNK More info
Beta Amyloid 13-22 HHQKLVFFAE More info
Beta Amyloid 15-1 QHHVEYGSDHRFEAD More info
Beta Amyloid 16-20 KLVFF More info
Beta Amyloid 16-22 KLVFFAE More info
Beta Amyloid 17-28 LVFFAEDVGSNK More info
Beta Amyloid 21-31 AEDVGSNKGAI More info
Beta Amyloid 21-34 AEDVGSNKGAIIGL More info
Beta Amyloid 21-35 AEDVGSNKGAIIGLM More info
Beta Amyloid 22-40 EDVGSNKGAIIGLMVGGVV More info
Beta Amyloid 25-35 GSNKGAIIGLM More info
Beta Amyloid 25-35 (Hcl) GSNKGAIIGLM More info
Beta Amyloid 25-35 amide GSNKGAIIGLM -amide More info
Beta Amyloid 25-35 amide (HCl) GSNKGAIIGLM -amide More info
Beta Amyloid 25-35 biotin (Biotin-Ahx-) GSNKGAIIGLM More info
Beta Amyloid 25-35 scrambled MAKGINGISGL More info
Beta Amyloid 25-39 GSNKGAIIGLMVGGV More info
Beta Amyloid 29-40 GAIIGLMVGGVV More info
Beta Amyloid 29-42 GAIIGLMVGGVVIA More info
Beta Amyloid 3-11 EFRHDSGYE More info
Beta Amyloid 3-11, Pyr3 (Pyr)FRHDSGYE More info
Beta Amyloid 3-6 EFRH More info
Beta Amyloid 3-6, Pyr3 (Pyr)FRH More info
Beta Amyloid 31-34 IIGL More info
Beta Amyloid 31-34 amide IIGL -amide More info
Beta Amyloid 31-34 propionyl (Propionyl-) IIGL -amide More info
Beta Amyloid 4-13 FRHDSGYEVH More info
Beta Amyloid 5-14 RHDSGYEVHH More info
Beta Amyloid 8-20 SGYEVHHQKLVFF More info