Cell permeable peptides
Cell permeable peptides are of different sizes, amino acid sequences, and charges, but they all have the ability to translocate the plasma membrane and facilitate the delivery of cargo molecules. Innovagen currently provides a range of cell penetrating peptides and drug delivery peptides, most popular of which are the Penetratin and HIV Tat peptides.Penetratin
Order Penetratin peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5024-1 | 85 EUR | BUY | ||||
| 5 mg | SP-5024-5 | 300 EUR | BUY | ||||
| 10 mg | SP-5024-10 | 450 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
HIV Tat
Order HIV Tat 48-60 Cys peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-HTAT-1 | 300 EUR | BUY | ||||
| 5 mg | SP-HTAT-5 | 640 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
More cell penetrating peptides
A part from the peptides listed, you could have any sequence in any amount custom made.| Name | Sequence | Info | |||||
|---|---|---|---|---|---|---|---|
| 105Y | SIPPEVKFNKPFVYLI | More info | |||||
| Antennapedia Leader Peptide | KKWKMRRNQFWVKVQRG | More info | |||||
| Anti-BetaGamma | AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE | More info | |||||
| Arg9 | RRRRRRRRR | More info | |||||
| Buforin | TRSSRAGLQFPVGRVHRLLRK | More info | |||||
| HIV Tat 47-57 | YGRKKRRQRRR | More info | |||||
| HIV Tat 48-57 | GRKKRRQRRR | More info | |||||
| HIV Tat 48-60 | GRKKRRQRRRPPQ -amide | More info | |||||
| HIV Tat 48-60 Cys | GRKKRRQRRRPPQC -amide | More info | |||||
| Lipid Membrane Translocating | KKAAAVLLPVLLAAP | More info | |||||
| Mastoparan | INLKALAALAKKIL -amide | More info | |||||
| MEK1 Nterm | MPKKKPTPIQLNP | More info | |||||
| MPGΔNLS | GALFLGFLGAAGSTMGAWSQPKSKRKV | More info | |||||
| MPS | AAVALLPAVLLALLAK | More info | |||||
| MPS-G?i2 | AAVALLPAVLLALLAKNNLKDCGLF | More info | |||||
| MPS-G?i3 | AAVALLPAVLLALLAKNNLKECGLY | More info | |||||
| NGR | CNGRCG | More info | |||||
| NLS | PKKKRKV | More info | |||||
| Penetratin | RQIKIWFQNRRMKWKK -amide | More info | |||||
| Penetratin Arg | RQIRIWFQNRRMRWRR -amide | More info | |||||
| Penetratin Arg Cys | RQIRIWFQNRRMRWRRC -amide | More info | |||||
| Penetratin Cys | RQIKIWFQNRRMKWKKC -amide | More info | |||||
| Pep-1 | KETWWETWWTEWSQPKKKRKV | More info | |||||
| RV-MAT | MNLLRKIVKNRRDEDTQKSSPASAPLDDG | More info | |||||
| SynB1 | RGGRLSYSRRRFSTSTGRA | More info | |||||
| Transdermal peptide | ACSSSPSKHCG | More info | |||||
| Transportan | GWTLNSAGYLLGKINLKALAALAKKIL | More info | |||||