Cell permeable peptides

Cell permeable peptides are of different sizes, amino acid sequences, and charges, but they all have the ability to translocate the plasma membrane and facilitate the delivery of cargo molecules. Innovagen currently provides a range of cell penetrating peptides and drug delivery peptides, most popular of which are the Penetratin and HIV Tat peptides.

Penetratin

Order Penetratin peptide

Amount Cat.No.        Unit price    
  1 mg SP-5024-1 85 EUR   BUY
  5 mg SP-5024-5 300 EUR   BUY
  10 mg SP-5024-10 450 EUR   BUY
 
For larger amounts please inquire.  

HIV Tat

Order HIV Tat 48-60 Cys peptide

Amount Cat.No.        Unit price    
  1 mg SP-HTAT-1 300 EUR   BUY
  5 mg SP-HTAT-5 630 EUR   BUY
 
For larger amounts please inquire.  


More cell penetrating peptides

A part from the peptides listed, you could have any sequence in any amount custom made.

Name   Sequence         Info
105Y SIPPEVKFNKPFVYLI More info
Antennapedia Leader Peptide KKWKMRRNQFWVKVQRG More info
Anti-BetaGamma AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE More info
Arg9 RRRRRRRRR More info
Buforin TRSSRAGLQFPVGRVHRLLRK More info
HIV Tat 47-57 YGRKKRRQRRR More info
HIV Tat 48-57 GRKKRRQRRR More info
HIV Tat 48-60 GRKKRRQRRRPPQ -amide More info
HIV Tat 48-60 Cys GRKKRRQRRRPPQC -amide More info
Lipid Membrane Translocating KKAAAVLLPVLLAAP More info
Mastoparan INLKALAALAKKIL -amide More info
MEK1 Nterm MPKKKPTPIQLNP More info
MPGΔNLS GALFLGFLGAAGSTMGAWSQPKSKRKV More info
MPS AAVALLPAVLLALLAK More info
MPS-G?i2 AAVALLPAVLLALLAKNNLKDCGLF More info
MPS-G?i3 AAVALLPAVLLALLAKNNLKECGLY More info
NGR CNGRCG More info
NLS PKKKRKV More info
Penetratin RQIKIWFQNRRMKWKK -amide More info
Penetratin Arg RQIRIWFQNRRMRWRR -amide More info
Penetratin Arg Cys RQIRIWFQNRRMRWRRC -amide More info
Penetratin Cys RQIKIWFQNRRMKWKKC -amide More info
Pep-1 KETWWETWWTEWSQPKKKRKV More info
RV-MAT MNLLRKIVKNRRDEDTQKSSPASAPLDDG More info
SynB1 RGGRLSYSRRRFSTSTGRA More info
Transdermal peptide ACSSSPSKHCG More info
Transportan GWTLNSAGYLLGKINLKALAALAKKIL More info