LL-37 peptide

Name LL-37
Sequence [LL-37, 37 aa]
3-letter-code Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser
Notes >95% purity. Also available as LL-37 : Ultra-pure at >98% purity.
Molecular weight 4493.33
Counter ion TFA
Solubilization Soluble in pure water.
Description The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18).
References M. Chromek, Z. Slamová, P. Bergman, L. Kovács, L. Podracká, I. Ehrén, T. Hökfelt, G.H. Gudmundsson, R.L. Gallo, B. Agerberth & A. Brauner. 2006. The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nature Medicine 2006 12:636-641

L. Bandholtz, G. Jacobsson Ekman, M. Vilhelmsson, E. Buentke, B. Agerberth, A. Scheynius, G. H. Gudmundsson. 2006. Antimicrobial Peptide LL-37 Internalized by Immature Human Dendritic Cells Alters their Phenotype. Scandinavian Journal of Immunology 63 (6), 410–419.
               

Order LL-37 peptide

Amount Cat.No.        Unit price    
  1 mg SP-LL37-1 350 EUR   BUY
  1 mg x 2 SP-LL37-1x2 510 EUR   BUY
  5 mg SP-LL37-5 960 EUR   BUY
 
For larger amounts please inquire.  

Labeled and modified LL-37

Name              
LL-37 5-FAM 5-Carboxyfluorescein on N-terminus.
LL-37 5-TAMRA 5-Carboxytetramethylrhodamine on N-terminus.
LL-37 biotin Biotin via a 6-carbon spacer (Ahx) on N-terminus.
LL-37 Lys 5-TAMRA LL-37 with 5-TAMRA labeled Lysine at C-terminus. Amide on C-terminus.
LL-37 reverse Reverse sequence of LL-37.
LL-37 scrambled Scrambled version of LL-37.

LL-37 antibody

Information
LL-37 antibody product description

LL-37 affinity columns

Affinity columns are custom made depending on your requirements. Please inquire for more information.
Information
Inquire for LL-37 peptide affinity column
Inquire for LL-37 antibody affinity column

Related peptides

Name   Sequence          
Cys-LL-37 CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
LL-37 (acetate) [LL-37, 37 aa]
LL-37 : Ultra-pure [LL-37, 37 aa]
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES
LL-37 FK-13 FKRIVQRIKDFLR
LL-37 FKR FKRIVQRIKDFLRNLVPRTES
LL-37 GKE GKEFKRIVQRIKDFLRNLVPR
LL-37 KRI KRIVQRIKDFLRNLVPRTES
LL-37 LLG LLGDFFRKSKEKIGKEFKRIV
LL-37 RKS RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 SKE SKEKIGKEFKRIVQRIKDFLR
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC