LL-37 LLG peptide

Name LL-37 LLG
Sequence LLGDFFRKSKEKIGKEFKRIV
3-letter-code Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val
Molecular weight 2539.06
Counter ion TFA
Description This LL-37 fragment corresponds to aa 134-154 of the human cationic antimicrobial protein 18 (hCAP18).
References T Sigurdardottir, P Andersson, M Davoudi, M Malmsten, A Schmidtchen, M Bodelsson. 2006. In Silico Identification and Biological Evaluation of Antimicrobial Peptides Based on Human Cathelicidin LL-37. Antimicrobial Agents and Chemotherapy 2006, p. 2983-2989 Vol. 50, No. 9
               

Order LL-37 LLG peptide

Amount Cat.No.        Unit price    
  1 mg SP-LL37-LLG-1 400 EUR   BUY
  5 mg SP-LL37-LLG-5 850 EUR   BUY
 
For larger amounts please inquire.  

LL-37 LLG antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Cys-LL-37 CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
LL-37 [LL-37, 37 aa]
LL-37 (acetate) [LL-37, 37 aa]
LL-37 : Ultra-pure [LL-37, 37 aa]
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES
LL-37 FK-13 FKRIVQRIKDFLR
LL-37 FKR FKRIVQRIKDFLRNLVPRTES
LL-37 GKE GKEFKRIVQRIKDFLRNLVPR
LL-37 KRI KRIVQRIKDFLRNLVPRTES
LL-37 RKS RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 SKE SKEKIGKEFKRIVQRIKDFLR
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC