LL-37 KRI peptide

Name LL-37 KRI
Synonyms KR-20
Sequence KRIVQRIKDFLRNLVPRTES
3-letter-code Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser
Molecular weight 2468.93
Counter ion TFA
Description This LL-37 fragment corresponds to aa 151-170 of the human cationic antimicrobial protein 18 (hCAP18).
               

Order LL-37 KRI peptide

Amount Cat.No.        Unit price    
  1 mg SP-LL37-KRI-1 340 EUR   BUY
  5 mg SP-LL37-KRI-5 670 EUR   BUY
 
For larger amounts please inquire.  

LL-37 KRI antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Cys-LL-37 CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
LL-37 [LL-37, 37 aa]
LL-37 (acetate) [LL-37, 37 aa]
LL-37 : Ultra-pure [LL-37, 37 aa]
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES
LL-37 FK-13 FKRIVQRIKDFLR
LL-37 FKR FKRIVQRIKDFLRNLVPRTES
LL-37 GKE GKEFKRIVQRIKDFLRNLVPR
LL-37 LLG LLGDFFRKSKEKIGKEFKRIV
LL-37 RKS RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 SKE SKEKIGKEFKRIVQRIKDFLR
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC