LL-37 FK-13 peptide

Name LL-37 FK-13
Sequence FKRIVQRIKDFLR
3-letter-code Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg
Molecular weight 1719.11
Counter ion TFA
Solubilization Soluble in pure water.
Description This LL-37 fragment corresponds to aa 150-162 of the human cationic antimicrobial protein 18 (hCAP18).
               

Order LL-37 FK-13 peptide

Amount Cat.No.        Unit price    
  1 mg SP-4582-1 290 EUR   BUY
  5 mg SP-4582-5 590 EUR   BUY
 
For larger amounts please inquire.  

Labeled and modified LL-37 FK-13

Name              
LL-37 FK-13 rev

LL-37 FK-13 antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Cys-LL-37 CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
LL-37 [LL-37, 37 aa]
LL-37 (acetate) [LL-37, 37 aa]
LL-37 : Ultra-pure [LL-37, 37 aa]
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES
LL-37 FKR FKRIVQRIKDFLRNLVPRTES
LL-37 GKE GKEFKRIVQRIKDFLRNLVPR
LL-37 KRI KRIVQRIKDFLRNLVPRTES
LL-37 LLG LLGDFFRKSKEKIGKEFKRIV
LL-37 RKS RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 SKE SKEKIGKEFKRIVQRIKDFLR
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC