LL-37 Citrulline peptide

Name LL-37 Citrulline
Sequence LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES
3-letter-code Leu - Leu - Gly - Asp - Phe - Phe - Cit - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Cit - Ile - Val - Gln - Cit - Ile - Lys - Asp - Phe - Leu - Cit - Asn - Leu - Val - Pro - Cit - Thr - Glu - Ser
Notes Arginine is replaced by Citrulline
Molecular weight 4498.19
Counter ion TFA
Solubilization Soluble in pure water.
Description The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18).
               

Order LL-37 Citrulline peptide

Amount Cat.No.        Unit price    
  1 mg SP-5380-1 350 EUR   BUY
  5 mg SP-5380-5 950 EUR   BUY
 
For larger amounts please inquire.  

LL-37 Citrulline antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Cys-LL-37 CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
LL-37 [LL-37, 37 aa]
LL-37 (acetate) [LL-37, 37 aa]
LL-37 : Ultra-pure [LL-37, 37 aa]
LL-37 FK-13 FKRIVQRIKDFLR
LL-37 FKR FKRIVQRIKDFLRNLVPRTES
LL-37 GKE GKEFKRIVQRIKDFLRNLVPR
LL-37 KRI KRIVQRIKDFLRNLVPRTES
LL-37 LLG LLGDFFRKSKEKIGKEFKRIV
LL-37 RKS RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 SKE SKEKIGKEFKRIVQRIKDFLR
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC