Apelin 13, myristoyl peptide

Name Apelin 13, myristoyl
Sequence Myr-QRPRLSHKGPMPF
3-letter-code Myr- Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
N-terminus Myristoyl
Molecular weight 1761.21
               

Order Apelin 13, myristoyl peptide

Amount Cat.No.        Unit price    
  1 mg SP-5126-1 140 EUR   BUY
  5 mg SP-5126-5 570 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF