Apelin 13, stearoyl peptide

Name Apelin 13, stearoyl
Sequence Ste-QRPRLSHKGPMPF
3-letter-code Ste- Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
N-terminus Stearoyl
Molecular weight 1816.31
               

Order Apelin 13, stearoyl peptide

Amount Cat.No.        Unit price    
  1 mg SP-5127-1 140 EUR   BUY
  5 mg SP-5127-5 570 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF