Apelin 12 FRET peptide

Name Apelin 12 FRET
Sequence MCA-RPRLSHKGPMP(Dap-Dnp)-NH2
3-letter-code MCA- Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Dap(Dnp) -NH2
N-terminus (7-methoxycoumarin-4-yl)acetyl
C-terminus Amide
Molecular weight 1742.94
Description This Apelin Cleavage FRET Peptide is labeled with MCA at the N-terminus and Dap(Dnp) at the C-terminus.
               

Order Apelin 12 FRET peptide

Amount Cat.No.        Unit price    
  1 mg SP-5122-1 290 EUR   BUY
  5 mg SP-5122-5 1240 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 12 FRET bundle may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 13, Pyr1, human (Pyr)RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF