CAP-18 peptide

Name CAP-18
Sequence GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
3-letter-code Gly - Leu - Arg - Lys - Arg - Leu - Arg - Lys - Phe - Arg - Asn - Lys - Ile - Lys - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Gln - Gly - Leu - Leu - Pro - Lys - Leu - Ala - Pro - Arg - Thr - Asp - Tyr
Molecular weight 4433.45
Counter ion TFA
Solubilization Soluble in pure water.
Description CAP-18 is the rabbit homologue of LL-37.
References Raqib, R., P. Sarker, P. Bergman, G. Ara, M. Lindh, D. A. Sack, K. M. Nasirul Islam, G. H. Gudmundsson, J. Andersson, and B. Agerberth. 2006. Improved outcome in shigellosis associated with butyrate induction of an endogenous peptide antibiotic. Proc. Natl. Acad. Sci. USA 103:9178-9183.
               

Order CAP-18 peptide

Amount Cat.No.        Unit price    
  1 mg SP-4541-1 350 EUR   BUY
  5 mg SP-4541-5 1550 EUR   BUY
 
For larger amounts please inquire.  

CAP-18 antibody

Information
CAP-18 antibody product description