| Name |
CRAMP biotin |
| Sequence |
Biotin-Ahx-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| 3-letter-code |
Biotin-Ahx- Gly - Leu - Leu - Arg - Lys - Gly - Gly - Glu - Lys - Ile - Gly - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Lys - Asn - Phe - Phe - Gln - Lys - Leu - Val - Pro - Gln - Pro - Glu - Gln |
| N-terminus |
Biotin via a 6-carbon spacer (Ahx) |
| Molecular weight |
4218.12 |
| Counter ion |
TFA |
| Description |
The anti-microbial peptide CRAMP corresponds to aa 140-173 of the mouse cathelicidin like protein (MCLP). This peptide is labeled with biotin at the N-terminus via a 6-carbon spacer (Ahx). |
| |
|
|
|
|
|
|
|
