CRAMP peptide

Name CRAMP
Synonyms mCRAMP, MCLP
Sequence GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
3-letter-code Gly - Leu - Leu - Arg - Lys - Gly - Gly - Glu - Lys - Ile - Gly - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Lys - Asn - Phe - Phe - Gln - Lys - Leu - Val - Pro - Gln - Pro - Glu - Gln
Molecular weight 3878.67
Counter ion TFA
Solubilization Soluble in pure water.
Description The anti-microbial peptide CRAMP corresponds to aa 140-173 of the mouse cathelicidin like protein (MCLP).
References P. Bergman, L. Johansson, H. Wan, A. Jones, R. L. Gallo, G. H. Gudmundsson, T. Hökfelt, A-B Jonsson, and B. Agerberth Induction of the Antimicrobial Peptide CRAMP in the Blood-Brain Barrier and Meninges after Meningococcal Infection Infect Immun. 2006;74(12):6982–6991.

M. Chromek, Z. Slamová1, P. Bergman, L. Kovács, L. Podracká, I. Ehrén, T. Hökfelt, G.H. Gudmundsson, R. L. Gallo, B. Agerberth & A. Brauner. 2006. The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nature Medicine - 12, 636-641.
               

Order CRAMP peptide

Amount Cat.No.        Unit price    
  1 mg SP-CRPS-1 320 EUR   BUY
  5 mg SP-CRPS-5 1430 EUR   BUY
 
For larger amounts please inquire.  

Labeled and modified CRAMP

Name              
CRAMP biotin Biotin via a 6-carbon spacer (Ahx) on N-terminus.

CRAMP antibody

Information
CRAMP antibody product description

Related peptides

Name   Sequence          
CRAMP 1-39 ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ