LL-37 reverse peptide

Name LL-37 reverse
Sequence SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
3-letter-code Ser - Glu - Thr - Arg - Pro - Val - Leu - Asn - Arg - Leu - Phe - Asp - Lys - Ile - Arg - Gln - Val - Ile - Arg - Lys - Phe - Glu - Lys - Gly - Ile - Lys - Glu - Lys - Ser - Lys - Arg - Phe - Phe - Asp - Gly - Leu - Leu
Notes Reverse sequence of LL-37.
Molecular weight 4493.33
Counter ion TFA
Solubilization Soluble in pure water.
Description The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This is the reversed sequence.
               

Order LL-37 reverse peptide

Amount Cat.No.        Unit price    
  1 mg SP-5220-1 350 EUR   BUY
  5 mg SP-5220-5 1570 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for LL-37 may contain more information and related peptides.

Related peptides

Name   Sequence          
Cys-LL-37 CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Cys-LL-37-Cys CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC
LL-37 (acetate) [LL-37, 37 aa]
LL-37 : Ultra-pure [LL-37, 37 aa]
LL-37 Citrulline LLGDFF(Cit )KSKEKIGKE FK(Cit)IVQ (Cit)IKDFL (Cit)NLVP( Cit)TES
LL-37 FK-13 FKRIVQRIKDFLR
LL-37 FKR FKRIVQRIKDFLRNLVPRTES
LL-37 GKE GKEFKRIVQRIKDFLRNLVPR
LL-37 KRI KRIVQRIKDFLRNLVPRTES
LL-37 LLG LLGDFFRKSKEKIGKEFKRIV
LL-37 RKS RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 SKE SKEKIGKEFKRIVQRIKDFLR
LL-37-Cys LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC