Apelin 13, Pyr1, dL5D6T12Y13 peptide

Name Apelin 13, Pyr1, dL5D6T12Y13
Sequence (Pyr)RPR(dL)DHKGPMTY
3-letter-code Pyr - Arg - Pro - Arg - d - Leu - Asp - His - Lys - Gly - Pro - Met - Thr - Tyr
Notes d-Leu 5, Ser 6 replaced by Asp, Pro 12 by Thr, Phe 13 by Tyr.
Molecular weight 1581.82
               

Order Apelin 13, Pyr1, dL5D6T12Y13 peptide

Amount Cat.No.        Unit price    
  1 mg SP-5192-1 75 EUR   BUY
  5 mg SP-5192-5 290 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF