Apelin 13, Pyr1, K4, Y13 peptide

Name Apelin 13, Pyr1, K4, Y13
Sequence (Pyr)RPKLSHKGPMPY
3-letter-code Pyr - Arg - Pro - Lys - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Tyr
Notes Arg 4 replaced by Lys, Phe 13 replaced by Tyr.
Molecular weight 1521.81
               

Order Apelin 13, Pyr1, K4, Y13 peptide

Amount Cat.No.        Unit price    
  1 mg SP-5176-1 75 EUR   BUY
  5 mg SP-5176-5 290 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF