Apelin 13, Pyr1, A06 peptide
Name | Apelin 13, Pyr1, A06 | ||||||
Sequence | (Pyr)RPRASHKGPMPF-NH2 | ||||||
3-letter-code | Pyr - Arg - Pro - Arg - Ala - Ser - His - Lys - Gly - Pro - Met - Pro - Phe -NH2 | ||||||
C-terminus | Amide | ||||||
Notes | Ser 6 is replaced by an Alanine (Ala). | ||||||
Molecular weight | 1490.76 | ||||||
Order Apelin 13, Pyr1, A06 peptide
Amount | Cat.No. | Unit price | |||||
---|---|---|---|---|---|---|---|
1 mg | SP-5133-1 | 95 EUR | BUY | ||||
5 mg | SP-5133-5 | 370 EUR | BUY | ||||
For larger amounts please inquire. |
The catalog entry for Apelin 13, Pyr1 - Alanine scan may contain more information and related peptides.
Related peptides
Name | Sequence | ||||||
---|---|---|---|---|---|---|---|
Apelin 12, human | RPRLSHKGPMPF | ||||||
Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF | ||||||
Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |