Name Apelin 13, Pyr1 - Alanine scan
Sequence   
3-letter-code    
Description This set of twelve peptides forms a complete Alanine scan of Apelin 13. The amount states the amount delivered of each of the twelve peptides. Each of the individual peptides of this set is also available separately.
               

Order

Amount Cat.No.        Unit price    
  1 mg SP-5128-1 890 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Apelin 13, Pyr1 - Alanine scan

Name              
Apelin 13, Pyr1, A02 Arg 2 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A03 Pro 3 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A04 Arg 4 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A05 Leu 5 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A06 Ser 6 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A07 His 7 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A08 Lys 8 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A09 Gly 9 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A10 Pro 10 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A11 Met 11 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A12 Pro 12 is replaced by an Alanine (Ala).
Apelin 13, Pyr1, A13 Phe 13 is replaced by an Alanine (Ala).

Custom peptide array

Innovagen also offers a custom Alanin scan peptide array synthesis service.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF