Apelin 13, Pyr1, A02 peptide

Name Apelin 13, Pyr1, A02
Sequence (Pyr)APRLSHKGPMPF-NH2
3-letter-code Pyr - Ala - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe -NH2
C-terminus Amide
Notes Arg 2 is replaced by an Alanine (Ala).
Molecular weight 1447.73
               

Order Apelin 13, Pyr1, A02 peptide

Amount Cat.No.        Unit price    
  1 mg SP-5129-1 95 EUR   BUY
  5 mg SP-5129-5 370 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1 - Alanine scan may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 13, Pyr1, human (Pyr)RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF