PDKtide biotin peptide
| Name | PDKtide biotin | ||||||
| Sequence | Biotin-Ahx-KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC | ||||||
| 3-letter-code | Biotin-Ahx- Lys - Thr - Phe - Cys - Gly - Thr - Pro - Glu - Tyr - Leu - Ala - Pro - Glu - Val - Arg - Arg - Glu - Pro - Arg - Ile - Leu - Ser - Glu - Glu - Glu - Gln - Glu - Met - Phe - Arg - Asp - Phe - Asp - Tyr - Ile - Ala - Asp - Trp - Cys | ||||||
| N-terminus | Biotin via a 6-carbon spacer (Ahx) | ||||||
| Molecular weight | 5110.80 | ||||||
| Solubilization | Soluble in pure water. | ||||||
Order PDKtide biotin peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5219-1 | 140 EUR | BUY | ||||
| 5 mg | SP-5219-5 | 530 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for PDKtide may contain more information and related peptides.
