Apelin 13, Pyr1, K4, D6, T12 peptide
| Name | Apelin 13, Pyr1, K4, D6, T12 | ||||||
| Sequence | (Pyr)RPKLDHKGPMTF | ||||||
| 3-letter-code | Pyr - Arg - Pro - Lys - Leu - Asp - His - Lys - Gly - Pro - Met - Thr - Phe | ||||||
| Notes | Arg 4 replaced by Lys, Ser 6 by Asp, Pro 12 by Thr. | ||||||
| Molecular weight | 1537.81 | ||||||
Order Apelin 13, Pyr1, K4, D6, T12 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5187-1 | 80 EUR | BUY | ||||
| 5 mg | SP-5187-5 | 310 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||