Apelin 36, human peptide

Name		Apelin 36, human
Sequence		LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
3-letter-code		Leu - Val - Gln - Pro - Arg - Gly - Ser - Arg - Asn - Gly - Pro - Gly - Pro - Trp - Gln - Gly - Gly - Arg - Arg - Lys - Phe - Arg - Arg - Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
Molecular weight		4195.89
Description		Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Apelin 36 is a 36 amino acid peptide fragment corresponding to the sequence 42-77.

Order Apelin 36, human peptide

Amount	Cat.No.	Unit price
1 mg	SP-5118-1	260 EUR	BUY
5 mg	SP-5118-5	1030 EUR	BUY

For larger amounts please inquire.

Please inquire for pricing and availability.