Apelin 17, human peptide

Name Apelin 17, human
Sequence KFRRQRPRLSHKGPMPF
3-letter-code Lys - Phe - Arg - Arg - Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
Molecular weight 2138.58
Description Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Apelin 17 is a 17 amino acid peptide fragment corresponding to the sequence 61-77. It is also found in bovine, rat, and mouse.
               

Order Apelin 17, human peptide

Amount Cat.No.        Unit price    
  1 mg SP-5119-1 95 EUR   BUY
  5 mg SP-5119-5 360 EUR   BUY
 
For larger amounts please inquire.  

Apelin 17, human antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 13, Pyr1, human (Pyr)RPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF