Apelin 13, palmitoyl peptide

Name Apelin 13, palmitoyl
Sequence Pal-QRPRLSHKGPMPF
3-letter-code Pal- Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
N-terminus Palmitoyl
Molecular weight 1789.27
               

Order Apelin 13, palmitoyl peptide

Amount Cat.No.        Unit price    
  1 mg SP-5124-1 140 EUR   BUY
  5 mg SP-5124-5 570 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF