Apelin 13, Pyr1, human peptide

Name Apelin 13, Pyr1, human
Sequence (Pyr)RPRLSHKGPMPF
3-letter-code Pyr - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
Molecular weight 1533.82
Description Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Apelin 13 is a 13 amino acid peptide fragment corresponding to the sequence 65-77. It is also found in bovine, rat, and mouse. This Description has the N-terminal pyroglutamylation of Gln.
               

Order Apelin 13, Pyr1, human peptide

Amount Cat.No.        Unit price    
  1 mg SP-5120-1 80 EUR   BUY
  5 mg SP-5120-5 310 EUR   BUY
 
For larger amounts please inquire.  

Labeled and modified Apelin 13, Pyr1, human

Name              
Apelin 13, H1, K7 Gln 1 replaced by His, His 7 replaced by Lys.
Apelin 13, lauroyl Lauroyl on N-terminus.
Apelin 13, myristoyl Myristoyl on N-terminus.
Apelin 13, palmitoyl Palmitoyl on N-terminus.
Apelin 13, Pyr1 - Alanine scan
Apelin 13, Pyr1, 13C/15N Pro 3 and Pro 12 are labelled with the stable isotopes 13C/15N, adding a total of 12 Da to the molecular weight of the peptide.
Apelin 13, Pyr1, 13C/15N, 5dL Pro 3 and Pro 12 are labelled with the stable isotopes 13C/15N, adding a total of 12 Da to the molecular weight of the peptide. D-form of Leu 5.
Apelin 13, Pyr1, 13C/15N, 6dS Pro 3 and Pro 12 are labelled with the stable isotopes 13C/15N, adding a total of 12 Da to the molecular weight of the peptide. D-form of Ser 6.
Apelin 13, Pyr1, C11 Met 11 is replaced by Cysteine (Cys).
Apelin 13, Pyr1, C6 Ser 6 is replaced by Cysteine (Cys).
Apelin 13, Pyr1, D6 Ser 6 is replaced by Aspartic acid (Asp).
Apelin 13, Pyr1, D6, I12 Ser 6 replaced Asp, Pro 12 replaced by Ile.
Apelin 13, Pyr1, D6, K7 Ser 6 replaced Asp, His 7 replaced by Lys.
Apelin 13, Pyr1, D6, K7, T12 Ser 6 replaced by Asp, His 7 by Lys, Pro 12 by Thr.
Apelin 13, Pyr1, D6, T12 Ser 6 replaced by Asp, Pro 12 replaced by Thr.
Apelin 13, Pyr1, dL5, D6 d-Leu 5, Ser 6 is replaced by Aspartic acid (Asp).
Apelin 13, Pyr1, dL5, D6, T12 d-Leu 5, Ser 6 replaced by Asp, Pro 12 by Thr.
Apelin 13, Pyr1, dL5, D6, Y13 d-Leu 5, Ser 6 replaced by Asp, Phe 13 by Tyr.
Apelin 13, Pyr1, dL5D6T12Y13 d-Leu 5, Ser 6 replaced by Asp, Pro 12 by Thr, Phe 13 by Tyr.
Apelin 13, Pyr1, E2 Arg 2 is replaced by Glutamic acid (Glu).
Apelin 13, Pyr1, E4 Arg 4 is replaced by Glutamic acid (Glu).
Apelin 13, Pyr1, F11 Met 11 is replaced by Phenylalanine (Phe).
Apelin 13, Pyr1, F5 Leu 5 is replaced by Phenylalanine (Phe).
Apelin 13, Pyr1, F7 His 7 is replaced by Phenylalanine (Phe).
Apelin 13, Pyr1, H8 Lys 8 is replaced by Histidine (His).
Apelin 13, Pyr1, I12 Pro 12 is replaced by Isoleucine (Ile).
Apelin 13, Pyr1, I5 Leu 5 is replaced by Isoleucine (Ile).
Apelin 13, Pyr1, I5, D6 Leu 5 replaced Ile, Ser 6 replaced by Asp.
Apelin 13, Pyr1, I5, I12 Leu 5 and Pro 12 replaced by Ile
Apelin 13, Pyr1, I5, K7 Leu 5replaced by Ile, His 7 replaced by Lys.
Apelin 13, Pyr1, I5, Y13 Leu 5 replaced by Ile, Phe 13 replaced by Tyr.
Apelin 13, Pyr1, K4, D6 Arg 4 replaced by Lys, Ser 6 replaced by Asp.
Apelin 13, Pyr1, K4, D6, T12 Arg 4 replaced by Lys, Ser 6 by Asp, Pro 12 by Thr.
Apelin 13, Pyr1, K4, dL5, Y13 Arg 4 replaced by Lys, d-Leu 5, Phe 13 replaced by Tyr.
Apelin 13, Pyr1, K4, I12 Arg 4 replaced by Lys, Pro 12 replaced by Ile.
Apelin 13, Pyr1, K4, I5 Arg 4 replaced by Lys, Leu 5 replaced by Ile.
Apelin 13, Pyr1, K4, T12 Arg 4 replaced Lys, Pro 12 replaced by Thr.
Apelin 13, Pyr1, K4, Y13 Arg 4 replaced by Lys, Phe 13 replaced by Tyr.
Apelin 13, Pyr1, K7 His 7 is replaced by Lysine (Lys).
Apelin 13, Pyr1, K7, I12 His 7 replaced by Lys, Pro 12 replaced by Ile.
Apelin 13, Pyr1, K7, Y13 His 7 replaced by Lys, Phe 13 replaced by Tyr.
Apelin 13, Pyr1, L13 Phe 13 is replaced by Leucine (Leu).
Apelin 13, Pyr1, N11 Met 11 is replaced by Asparagine (Asn).
Apelin 13, Pyr1, P7 His 7 is replaced by Proline (Pro).
Apelin 13, Pyr1, R7 His 7 is replaced by Arginine (Arg).
Apelin 13, Pyr1, S9 Gly 9 is replaced by Serine (Ser).
Apelin 13, Pyr1, T12 Pro 12 is replaced by Threonine (Thr).
Apelin 13, Pyr1, T6 Ser 6 is replaced by Threonine (Thr).
Apelin 13, Pyr1, V5 Leu 5 is replaced by Valine (Val).
Apelin 13, Pyr1, V6 Ser 6 is replaced by Valine (Val).
Apelin 13, Pyr1, Y6 Ser 6 is replaced by Tyrosine (Tyr).
Apelin 13, Pyr1, Y7 His 7 is replaced by Tyrosine (Tyr).
Apelin 13, stearoyl Stearoyl on N-terminus.

Apelin 13, Pyr1, human antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF