Apelin 13, Pyr1, N11 peptide

Name Apelin 13, Pyr1, N11
Sequence (Pyr)RPRLSHKGPNPF
3-letter-code Pyr - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Asn - Pro - Phe
Notes Met 11 is replaced by Asparagine (Asn).
Molecular weight 1516.73
               

Order Apelin 13, Pyr1, N11 peptide

Amount Cat.No.        Unit price    
  1 mg SP-5155-1 75 EUR   BUY
  5 mg SP-5155-5 290 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF