Apelin 13, Pyr1, F7 peptide
| Name | Apelin 13, Pyr1, F7 | ||||||
| Sequence | (Pyr)RPRLSFKGPMPF | ||||||
| 3-letter-code | Pyr - Arg - Pro - Arg - Leu - Ser - Phe - Lys - Gly - Pro - Met - Pro - Phe | ||||||
| Notes | His 7 is replaced by Phenylalanine (Phe). | ||||||
| Molecular weight | 1543.86 | ||||||
Order Apelin 13, Pyr1, F7 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5152-1 | 75 EUR | BUY | ||||
| 5 mg | SP-5152-5 | 290 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||