Apelin 13, Pyr1, 13C/15N, 5dL peptide

Name Apelin 13, Pyr1, 13C/15N, 5dL
Sequence (Pyr)RP*R(dL)SHKGPMP*F
3-letter-code Pyr - Arg - Pro* - Arg - d - Leu - Ser - His - Lys - Gly - Pro - Met - Pro* - Phe
Notes Pro 3 and Pro 12 are labelled with the stable isotopes 13C/15N, adding a total of 12 Da to the molecular weight of the peptide. D-form of Leu 5.
Molecular weight 1545.93
               

Order Apelin 13, Pyr1, 13C/15N, 5dL peptide

Amount Cat.No.        Unit price    
  0.1 mg SP-5199-01 340 EUR   BUY
  0.5 mg SP-5199-05 670 EUR   BUY
  1 mg SP-5199-1 840 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF