Apelin 12, 1-10, K3, D5 peptide

Name Apelin 12, 1-10, K3, D5
Sequence RPKLDHKGPM
3-letter-code Arg - Pro - Lys - Leu - Asp - His - Lys - Gly - Pro - Met
Notes Arg 3 is replaced by Lysine (Lys), Ser 5 is replaced by Aspartic acid (Asp). Missing the two C-terminal amino acids Pro Phe of Apelin 12.
Molecular weight 1178.42
               

Order Apelin 12, 1-10, K3, D5 peptide

Amount Cat.No.        Unit price    
  1 mg SP-5146-1 75 EUR   BUY
  5 mg SP-5146-5 290 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 12, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 13, Pyr1, human (Pyr)RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF