Name Apelin 12 FRET bundle
Description For a Fluorescence Resonance Energy Transfer (FRET) application, this pair contains the FRET peptide and its control . The amount states the amount delivered of each of the two peptides. The individual peptides of this set are also available separately.
               

Order

Amount Cat.No.        Unit price    
  1 mg SP-5200-1 410 EUR   BUY
  5 mg SP-5200-5 1670 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 12, human may contain more information and related peptides.

Apelin 12 FRET bundle

Name              
Apelin 12 FRET
Apelin 12 FRET control

Related peptides

Name   Sequence          
Apelin 13, Pyr1, human (Pyr)RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF