Anti-BetaGamma peptide

Name Anti-BetaGamma
Sequence AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
3-letter-code Ala - Ala - Val - Ala - Leu - Leu - Pro - Ala - Val - Leu - Leu - Ala - Leu - Leu - Ala - Val - Thr - Asp - Gln - Leu - Gly - Glu - Asp - Phe - Phe - Ala - Val - Asp - Leu - Glu - Ala - Phe - Leu - Gln - Glu - Phe - Gly - Leu - Leu - Pro - Glu - Lys - Glu
Molecular weight 4601.36
               

Order Anti-BetaGamma peptide

Amount Cat.No.        Unit price    
  0.5 mg SP-5230-05 350 EUR   BUY
  1 mg SP-5230-1 580 EUR   BUY
 
For larger amounts please inquire.  

Anti-BetaGamma antibody

Please inquire for pricing and availability.