Adrenomedullin (1-52) human peptide

Name Adrenomedullin (1-52) human
Sequence YRQSMNNFQG LRSFGCRFGT CTVQKLAHQI YQFTDKDKDN VAPRSKISPQ GY -NH2
3-letter-code Tyr - Arg - Gln - Ser - Met - Asn - Asn - Phe - Gln - Gly - Leu - Arg - Ser - Phe - Gly - Cys - Arg - Phe - Gly - Thr - Cys - Thr - Val - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Asn - Val - Ala - Pro - Arg - Ser - Lys - Ile - Ser - Pro - Gln - Gly - Tyr -NH2
C-terminus Amide
Disulphide connectivity Cys16-Cys21
Molecular weight 6028.81
Counter ion TFA
               

Order Adrenomedullin (1-52) human peptide

Amount Cat.No.        Unit price    
  0.5 mg SP-AM0152-05 430 EUR   BUY
  1 mg SP-AM0152-1 810 EUR   BUY
 
For larger amounts please inquire.  

Adrenomedullin (1-52) human antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
Adrenomedullin (13-52) human SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
PAMP (human) ARLDVASEFRKKWNKWALSR
PAMP (rat) ARLDTSSQFRKKWNKWALSR