ACTH 1-13 peptide

Name ACTH 1-13
Synonyms alpha-MSH 1-13, alpha-melanocyte-stimulating hormone
Sequence SYSMEHFRWGKPV
3-letter-code Ser - Tyr - Ser - Met - Glu - His - Phe - Arg - Trp - Gly - Lys - Pro - Val
Molecular weight 1623.86
               

Order ACTH 1-13 peptide

Amount Cat.No.        Unit price    
  1 mg SP-5287-1 60 EUR   BUY
  5 mg SP-5287-5 180 EUR   BUY
  10 mg SP-5287-10 330 EUR   BUY
 
For larger amounts please inquire.  

ACTH 1-13 antibody

Please inquire for pricing and availability.

Related peptides

Name   Sequence          
ACTH 1-10 SYSMEHFRWG
ACTH 1-16 SYSMEHFRWGKPVGKK
ACTH 1-17 SYSMEHFRWGKPVGKKR
ACTH 1-24 SYSMEHFRWGKPVGKKRRPVKVYP
ACTH 1-39 SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF