Name		Vitronectin 341-370
Sequence		APRPSLAKKQRFRHRNRKGYRSQRGHSRGR
3-letter-code		Ala - Pro - Arg - Pro - Ser - Leu - Ala - Lys - Lys - Gln - Arg - Phe - Arg - His - Arg - Asn - Arg - Lys - Gly - Tyr - Arg - Ser - Gln - Arg - Gly - His - Ser - Arg - Gly - Arg
Molecular weight		3645.17
Counter ion		TFA
References		Haemophilus influenzae Surface Fibrils Contribute to Serum Resistance by Interacting with Vitronectin T Hallstrom, E Trajkovska, A Forsgren, and K Riesbeck The Journal of Immunology, 2006, 177: 430-436.

Order Vitronectin 341-370 peptide

Amount	Cat.No.					Unit price
1 mg	SP-4355-1					1000 EUR	BUY
5 mg	SP-4355-5					1240 EUR	BUY
For larger amounts please inquire.

Vitronectin 341-370 antibody

Please inquire for pricing and availability.

Related peptides

Name		Sequence
Vitronectin 348-361		KKQRFRHRNRKGYR