Apelin 36, human peptide
| Name | Apelin 36, human | ||||||
| Sequence | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
| 3-letter-code | Leu - Val - Gln - Pro - Arg - Gly - Ser - Arg - Asn - Gly - Pro - Gly - Pro - Trp - Gln - Gly - Gly - Arg - Arg - Lys - Phe - Arg - Arg - Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe | ||||||
| Molecular weight | 4195.89 | ||||||
| Description | Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Apelin 36 is a 36 amino acid peptide fragment corresponding to the sequence 42-77. | ||||||
Order Apelin 36, human peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5118-1 | 260 EUR | BUY | ||||
| 5 mg | SP-5118-5 | 1030 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
Apelin 36, human antibody
Please inquire for pricing and availability.Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||