Name		Apelin 17, human
Sequence		KFRRQRPRLSHKGPMPF
3-letter-code		Lys - Phe - Arg - Arg - Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
Molecular weight		2138.58
Description		Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Apelin 17 is a 17 amino acid peptide fragment corresponding to the sequence 61-77. It is also found in bovine, rat, and mouse.

Order Apelin 17, human peptide

Amount	Cat.No.					Unit price
1 mg	SP-5119-1					100 EUR	BUY
5 mg	SP-5119-5					390 EUR	BUY
For larger amounts please inquire.

Apelin 17, human antibody

Please inquire for pricing and availability.

Related peptides

Name		Sequence
Apelin 12, human		RPRLSHKGPMPF
Apelin 13, Pyr1, human		(Pyr)RPRLSHKGPMPF
Apelin 36, human		LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF