Apelin 13, myristoyl peptide
| Name | Apelin 13, myristoyl | ||||||
| Sequence | Myr-QRPRLSHKGPMPF | ||||||
| 3-letter-code | Myr- Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe | ||||||
| N-terminus | Myristoyl | ||||||
| Molecular weight | 1761.21 | ||||||
Order Apelin 13, myristoyl peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5126-1 | 160 EUR | BUY | ||||
| 5 mg | SP-5126-5 | 630 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
