Apelin 13, Pyr1, S9 peptide
| Name | Apelin 13, Pyr1, S9 | ||||||
| Sequence | (Pyr)RPRLSHKSPMPF | ||||||
| 3-letter-code | Pyr - Arg - Pro - Arg - Leu - Ser - His - Lys - Ser - Pro - Met - Pro - Phe | ||||||
| Notes | Gly 9 is replaced by Serine (Ser). | ||||||
| Molecular weight | 1563.85 | ||||||
Order Apelin 13, Pyr1, S9 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5158-1 | 80 EUR | BUY | ||||
| 5 mg | SP-5158-5 | 310 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
