Apelin 13, Pyr1, D6, K7 peptide
| Name | Apelin 13, Pyr1, D6, K7 | ||||||
| Sequence | (Pyr)RPRLDKKGPMPF | ||||||
| 3-letter-code | Pyr - Arg - Pro - Arg - Leu - Asp - Lys - Lys - Gly - Pro - Met - Pro - Phe | ||||||
| Notes | Ser 6 replaced Asp, His 7 replaced by Lys. | ||||||
| Molecular weight | 1552.86 | ||||||
Order Apelin 13, Pyr1, D6, K7 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5178-1 | 80 EUR | BUY | ||||
| 5 mg | SP-5178-5 | 310 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
