Apelin 13, Pyr1, A06 peptide
| Name | Apelin 13, Pyr1, A06 | ||||||
| Sequence | (Pyr)RPRASHKGPMPF-NH2 | ||||||
| 3-letter-code | Pyr - Arg - Pro - Arg - Ala - Ser - His - Lys - Gly - Pro - Met - Pro - Phe -NH2 | ||||||
| C-terminus | Amide | ||||||
| Notes | Ser 6 is replaced by an Alanine (Ala). | ||||||
| Molecular weight | 1490.76 | ||||||
Order Apelin 13, Pyr1, A06 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5133-1 | 100 EUR | BUY | ||||
| 5 mg | SP-5133-5 | 410 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 13, Pyr1 - Alanine scan may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||