Apelin 12, 1-10, I4 peptide
| Name | Apelin 12, 1-10, I4 | ||||||
| Sequence | RPRISHKGPM | ||||||
| 3-letter-code | Arg - Pro - Arg - Ile - Ser - His - Lys - Gly - Pro - Met | ||||||
| Notes | Leu 4 is replaced by Isoleucine (Ile). Missing the two C-terminal amino acids Pro Phe of Apelin 12. | ||||||
| Molecular weight | 1178.43 | ||||||
Order Apelin 12, 1-10, I4 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5147-1 | 80 EUR | BUY | ||||
| 5 mg | SP-5147-5 | 310 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 12, human may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
