Apelin 12 FRET peptide
| Name | Apelin 12 FRET | ||||||
| Sequence | MCA-RPRLSHKGPMP(Dap-Dnp)-NH2 | ||||||
| 3-letter-code | MCA- Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Dap(Dnp) -NH2 | ||||||
| N-terminus | (7-methoxycoumarin-4-yl)acetyl | ||||||
| C-terminus | Amide | ||||||
| Molecular weight | 1742.94 | ||||||
| Description | This Apelin Cleavage FRET Peptide is labeled with MCA at the N-terminus and Dap(Dnp) at the C-terminus. | ||||||
Order Apelin 12 FRET peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5122-1 | 320 EUR | BUY | ||||
| 5 mg | SP-5122-5 | 1360 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 12 FRET bundle may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||