Apelin 13, lauroyl peptide

Name Apelin 13, lauroyl
Sequence Lau-QRPRLSHKGPMPF
3-letter-code Lau- Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
N-terminus Lauroyl
Molecular weight 1733.16
               

Order Apelin 13, lauroyl peptide

Amount Cat.No.        Unit price    
  1 mg SP-5125-1 140 EUR   BUY
  5 mg SP-5125-5 570 EUR   BUY
 
For larger amounts please inquire.  

The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.

Related peptides

Name   Sequence          
Apelin 12, human RPRLSHKGPMPF
Apelin 17, human KFRRQRPRLSHKGPMPF
Apelin 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF